PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 276aa    MW: 29309.8 Da    PI: 5.6988
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002735.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof64.32.2e-2079113236
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaC 36 
                 ++++l+cprC+s +tkfCy+nny+ +qPr++C++C
  Do002735.1  79 PDAILPCPRCNSVDTKFCYFNNYNEKQPRHYCRNC 113
                 67899****************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-1476113IPR003851Zinc finger, Dof-type
PfamPF027013.7E-1881115IPR003851Zinc finger, Dof-type
PROSITE profilePS5088416.19983137IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDASRGPDRD QHQDTAIQLF GLSIPVPGSS TPPPPRPHPS TKVADDGGSS QKGKADDPKS  60
EEAKADSGGS GEAKAFQKPD AILPCPRCNS VDTKFCYFNN YNEKQPRHYC RNCPAKEDEA  120
NTSSGSQVVL DLVLGSGDKK EERSCLPSAA VASGSSDNSE VGLSRLSLLP PMMPAPGIRA  180
HAVPFPQVSP LWSCFPGWPN GAWTVLGTTL PSLPPSSVAC SGGDSLALGK HPREEEKAEK  240
TFWVPKALRV TDPEEAAKST IWDSLGIKPD EGTFCK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987428.11e-72PREDICTED: cyclic dof factor 2-like, partial
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.17e-26cycling DOF factor 1